PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c11_6370V3.1.p
Common NamePHYPADRAFT_226476
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family CO-like
Protein Properties Length: 369aa    MW: 39674.7 Da    PI: 7.1383
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c11_6370V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.61.6e-05342437
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......H 37
                       + C+ ++   +  +C+ +  +lC  C  + H g       H
  Pp3c11_6370V3.1.p  3 KSCDACQASSAVVYCRADAAYLCLGCDGKVH-GanklasrH 42
                       67*****999****************99999.435555555 PP

2zf-B_box23.11.6e-074490242
           zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                       + ++C+ +e   +   C+ +   lC +C + +H+       H++vp+
  Pp3c11_6370V3.1.p 44 RLWMCEVCEVAAAVVTCKADAASLCVSCDTDIHSAnplaqrHERVPV 90
                       5689*****999*********************66899999999986 PP

3CCT69.68.2e-24301344144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea+++RYkeKr++RkFeK+irY+sRKa+AesRpR+KGrF+k++
  Pp3c11_6370V3.1.p 301 REARVMRYKEKRQKRKFEKTIRYASRKAYAESRPRIKGRFTKRT 344
                        9****************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.456147IPR000315B-box-type zinc finger
SMARTSM003362.2E-8147IPR000315B-box-type zinc finger
CDDcd000214.33E-5547No hitNo description
PROSITE profilePS5011910.3674390IPR000315B-box-type zinc finger
PfamPF006431.1E-54590IPR000315B-box-type zinc finger
CDDcd000215.94E-74690No hitNo description
SMARTSM003364.7E-94890IPR000315B-box-type zinc finger
PROSITE profilePS5101716.42301343IPR010402CCT domain
PfamPF062038.5E-18301343IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MPKSCDACQA SSAVVYCRAD AAYLCLGCDG KVHGANKLAS RHERLWMCEV CEVAAAVVTC  60
KADAASLCVS CDTDIHSANP LAQRHERVPV QPLFDCVSQF RGTHFSVLAP KNECNNNLLK  120
GDEDPAVAEA VSWLLPHPKT LSSAILRGIA AADEAPAFPF RERPFSPKLK KLKVEQAADI  180
YSDVDPFLVL DGGNGTGFQP DSMVPVHIPE GPDDSPSLAN STAPSSAINF RASQKSGCSY  240
GTSTLTHSMS CSSVDAAVVP DSSLSDISTP YSKALDSQDS QDLSGALVPH QASKPIDTVD  300
REARVMRYKE KRQKRKFEKT IRYASRKAYA ESRPRIKGRF TKRTDSDVEQ MFSSCTADSG  360
FGVVPSSC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.11140.0gametophore| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ8901080.0AJ890108.1 Physcomitrella patens col-3 gene for CONSTANS-like 3, exons 1-3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001783412.10.0predicted protein
TrEMBLA9TXS80.0A9TXS8_PHYPA; Predicted protein
STRINGPP1S364_5V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-69CONSTANS-like 4
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]